Archivo de la categoría: Genetica

Lygos: cómo crear una compañía de biología sintética en un trastero

fundadoreslygos

Eric Steen y Jeffrey Dietrich entraron por primera vez en el trastero en noviembre de 2012, no sabían si era el que iban a alquilar para lograr su objetivo, pero una vez dentro lo decidieron: ahí formarían su empresa de biología sintética. Eric y Dietrich miraron la habitación sucia y vacía dispuestos a transformarla en un laboratorio casero.

Así se fundó Lygos, una compañía creada por bioquímicos con ganas de mejorar el mundo empezando desde cero, como Apple o como Facebook, y con la novedad de ser un laboratorio de biología sintética, uno de los campos más innovadores y con mayor avance en el último año. Pero empecemos por el principio: ¿Qué es la biología sintética?

Seguir leyendo Lygos: cómo crear una compañía de biología sintética en un trastero

Ni A ni B ni 0. El descubrimiento de la sangre tipo “Vel”

sangre

El misterio comenzó en 1952, cuando una señora de 66 años enferma de cáncer de colon recibió una transfusión sanguínea y sorprendentemente sufrió un rechazo de la sangre del donante, aunque era de su mismo tipo. Los investigadores comprobaron que las defensas de la paciente atacaban a algún componente desconocido de la sangre que le transferían. Sin embargo fueron incapaces de aislar este componente, así que simplemente lo llamaron con el apellido de la paciente, VelEste fue el nacimiento de un nuevo tipo sanguíneo: “Vel negativo”.

Los glóbulos rojos de nuestra sangre están envueltos en moléculas llamadas antígenos. Estos componentes son los que reconocen nuestras defensas como seña de identidad para saber si una célula es nuestra o pertenece a otra persona, de este modo las defensas solo atacan a los glóbulos rojos que tienen moléculas a las que nuestro cuerpo no está acostumbrado. Los tipos sanguíneos comunes se refieren a los tres antígenos principales en nuestra sangre: el antígeno A, el antígeno B y el antígeno Rh. De esta manera nuestra sangre puede tener antígeno A (sangre A), antígeno B (sangre B), los dos (sangre AB) o ninguno (sangre 0). El Rh se señala con un signo positivo o negativo, indicando si lo tenemos o no.

Como nuestras defensas reconocen los antígenos extraños, la sangre sin ninguno de estos antígenos (es decir, sangre 0- ) se puede suministrar a cualquier paciente, da igual su tipo sanguíneo. Por eso a un paciente con este tipo sanguíneo se le llama donante universal. Pero a cambio estos pacientes no pueden recibir sangre de ningún otro tipo diferente a 0- ya que sus defensas atacarán a todos los antígenos comunes en el resto de tipos.

Aunque estos sean los antígenos más conocidos por todos y las principales guías en los hospitales, realmente existe una gran variedad de tipos sanguíneos raros presentes en una pequeña parte de la población. En estas “sangres raras” falta algún componente que suele estar en la mayoría de nosotros, así que al recibir una transfusión de sangre normal se produce una respuesta inmune. Uno de estos casos es la sangre Vel- pero hay cientos de tipos más. Cuando se dona sangre ésta es sometida a una serie de pruebas para determinar exactamente qué tipo de sangre es y a que pacientes se les puede suministrar, ya que igual que en los 0- los pacientes Vel- solo pueden recibir sangre de otro Vel-.

Incluso entre los tipos sanguíneos raros la sangre Vel es especial, ya que desde su descubrimiento en 1952 nadie había conseguido saber que antígeno era el que faltaba en los Vel negativos. De hecho para saber si una muestra de sangre era Vel- la única prueba posible consistía en poner en contacto una muestra de anticuerpos de un paciente Vel- reconocido para ver si reaccionaban con la sangre. Después de 60 años un grupo de investigadores de la Universidad de Vermont han conseguido purificar sangre Vel- y descubrir el antígeno que les falta. Es una pequeña molécula que no se había descubierto hasta ahora y la han bautizado como SMIM 1.

El equipo ha podido demostrar que la gente con sangre Vel- tienen una mutación en su ADN que le impiden a los glóbulos rojos de su sangre tener esta molécula. Cuando reciben una transfusión de sangre con glóbulos rojos normales (que tienen SMIM1) el cuerpo no reconoce a la molécula y ataca a la sangre extraña.

Con este son 33 los tipos de sangre rara cuyo antígeno es reconocido, pero aún quedan muchas más por descubrir. La ciencia aun busca respuestas a cada uno de estos pequeños misterios. Por ahora, si tienes la (mala) suerte de tener algún tipo de sangre rara no te preocupes, los bancos de sangre tienen una reserva a tu nombre.

Fuente | Live Science

Imagen | Eitb

Este articulo ha sido publicado primero en Medciencia. Entra y disfruta de otros artículos curiosos realizados por redactores de diferentes campos.

Los cameos científicos de Parque Jurásico

adnjurasicoSi quieres ser un buen escritor debes recopilar información sobre la temática de tu libro. Y si te llamas Michael Crichton, y tu novela trata sobre dinosaurios creados por ingeniería genética; reunirás a un grupo de investigadores expertos en genética para hablar con ellos sobre ADN, plásmidos y otros términos relevantes.

Por supuesto, estamos hablando de Jurassic Park, novela que saltó a la fama gracias a la película homónima dirigida por Steven Spielberg. El libro y la película tratan sobre el colapso producido en un parque temático con dinosaurios creados genéticamente a partir de ADN de dinosaurio extraído de mosquitos en ámbar.

Son muy interesantes todas las referencias a la genética y a la teoría del caos que incluye el libro. Se detienen explicando paso por paso la recreación de los dinosaurios,con páginas enteras llenas de secuencias de ADN y referencias a muchos términos de ingeniería genética, como plásmidos o recombinación génica. Sin embargo, en la película la conversación aparece menos detallada para ahorrar tiempo y se resume prácticamente a la secuencia de dibujos animados que el director del parque John Hammond expone a sus visitantes (Video en mala calidad y en ingles, lo siento)

Para documentarse acerca de los laboratorios modernos de biología y el aspecto que tienen,  Spielberg fue de visita a la Universidad de California en Los Ángeles. Un par de trabajadores del laboratorio donde estuvo obtuvieron pequeños papeles en la película en recompensa por su ayuda (para ser exactos, en el video superior,  el científico que aparece en el minuto 2:00 y los técnicos del minuto 2:40 son científicos reales).

Pero la relación entre Parque Jurásico y la ciencia es aun más estrecha, si os fijáis en el minuto 2:30 veréis a Mr. DNA hablando y esquivando una larga secuencia de ADN (expresada por la combinación de sus bases nitrogenadas: Adenina (A), Guanina (G), Citosina (C) y Timina (T)). La secuencia de ADN de esta escena no es inventada, es la que en el libro usa el científico ficticio Henry Wu como ejemplo de ADN extraído de dinosaurio.

Hoy en día es posible comparar esta supuesta secuencia de ADN de dinosaurio con todas las secuencias de ADN conocidas gracias a una herramienta llamada BLAST que permite buscar en un periodo corto de tiempo una secuencia de ADN entre una gran biblioteca online (todo esto de manera gratuita).  Si introducimos la secuencia del libro, comprobamos que el ADN de dinosaurio realmente no lo es, proviene de un organismo de lo más corriente y muy conocido por los científicos: la bacteria E. coli (para ser exactos, la secuencia pertenece a un plásmido de E.coli).

Como información adicional para los no iniciados, los plásmidos son secuencias de ADN circular que pueden duplicarse de manera independiente y transmitirse entre bacterias, actúan de vehículo para genes y ADN ajenos, siendo una especie de Pen USB biológico: pueden compartir información entre bacterias sobre resistencia a medicamentos o a otros patógenos. Los plásmidos son muy usados en la ingeniería genética para conseguir grandes cantidades de ADN en poco tiempo, solamente debes introducir en el plásmido el ADN que quieres y las bacterias se encargarán de darte una gran cantidad de copias.

Es fácil saber qué hacía el plásmido en un laboratorio de genética como el de Parque Jurásico, pero aun así no es ADN de dinosaurio. De hecho, si apareciese una secuencia así en los resultados de un laboratorio, se asume que es una contaminación (algo bastante posible teniendo en cuenta que se hizo un estudio que comprobaba que uno de cada dos carritos de la compra estaba contaminado con E.coli).

A pesar del todo, como Parque Jurásico solo es un libro, pensaron que nadie se molestaría en comprobar una secuencia de ADN que aparece en mitad del libro. Pero hubo alguien que lo hizo: Mark Boguski, un científico del NIH (National Institutes of Health, el Instituto Mundial de Salud de Estados Unidos) que está especializado en almacenamiento y recuperación de bases de datos.

Mark Boguski fue la primera persona que identificó la secuencia de ADN mencionada en el libro, e informó a Michael Crichton de su error. Crichton le pidió, en respuesta, que le suministrara una secuencia mas realista para la segunda parte que estaba escribiendo en ese momento, El mundo perdido.

Dicho y hecho, en El mundo perdido, el matemático Ian Malcolm descubre una serie de informes escritos por los primeros científicos que lograron criar dinosaurios. En uno de ellos viene la secuencia de aminoácidos de la proteína erif1 (“factor eritroide de transcripción”) procedente de un dinosaurio. La proteína existe de verdad, es la proteína Eryf1 de pollo. La idea de Mark no era mala, teniendo en cuenta que hay evidencias de la relación genética en común entre aves y dinosaurios.

Pero Mark quiso ir más allá de la anécdota e introdujo un mensaje secreto en el libro, en forma de cadena de ADN:

Es una referencia a una base de datos informática – dijo Malcolm -. De algún factorsanguíneo de dinosaurio. Algo relacionado con los glóbulos rojos.
– ¿Y ésa es la secuencia?
– No – respondió Malcolm. Hojeó los otros papeles. – No, la secuencia debería ser unaserie de nucleótidos… Aquí.
Separó una hoja.
SECUENCIA
1 GAATTCCGGA AGCGAGCAAG AGATAAGTCC TGGCATCAGA TACAGTTGGA GATAAGGACG
61 GACGTGTGGC AGCTCCCGCA GAGGATTCAC ATGATAATGA TAACCTCGGA GGATTACGCC
121 ATGGAGTTCG TGGCGCTGGG GGGGCGGATC GCGGGCTCCC CCACTCCGTT CCCTGATGAA
181 GCCGGAGCCT TCCTGGGGCT GGGGGGGGGC GAGAGGACGG AGGCGGGGGG GCTGCTGGCC
241 ACCCCCCAGT GGGTGCCGCC CGCCACCCAA  ATGGAGCCCC CCCACTACCT GGAGCTGCTG
301 CAACCCCCCC GGGGCAGCCC CCCCCATCCC TCCTCCGGGC CCCTACTGCC ACTCAGCAGC
361 GGGCCCCCAC CCTGCGAGGC CCGTGAGTGC GTCATGGCCA GGAAGAACTG CGGAGCGACG
421 GCAACGCCGC TGTGGCGCCG GGACGGCACC GGGCATTACC TGTGCAACTG GGCCTCAGCC
481 CTGCTGGTGA GTAAGCGCGC AGGCACAGTG TGCAGCCACG AGCGTGAAAA CTGCCAGACA
541 TCCACCACCA CTCTGTGGCG TCGCAGCCCC ATGGGGGACC CCGTCTGCAA CAACATTCAC
721 GCCTGCGGCC TCTACTACAA  ACTGCACCAA GTGAACCGCC CCCTCACGAT GCGCAAAGAC
781 GGAATCCAAA CCCGAAACCG  CAAAGTTTCC TCCAAGGGTA AAAAGCGGCG CCCCCCGGGG
841 GGGGGAAACC CCTCCGCCAC CGCGGGAGGG GGCGCTCCTA TGGGGGGAGG GGGGGACCCC
901 TCTATGCCCC CCCCGCCGCC CCCCCCGGCC GCCGCCCCC CTCAAAGCGA  CGCTCTGTAC
961 GCTCTCGGCC CCGTGGTCCT TTCGGGCCAT TTTCTGCCCT TTGGAAACTC CGGAGGGTTT
1021 TTTGGGGGGG GGGCGGGGGG TTACACGGCC CCCCCGGGGC TGAGCCCGCA GATTTAAATA
1081 ATAACTCTGA CGTGGGCAAG TGGGCCTTGC TGAGAAGACA GTGTAACATA ATAATTTGCA
1141 CCTCGGCAAT TGCAGAGGGT CGATCTCCAC  TTTGGACACA ACAGGGCTAC TCGGTAGGAC
1201 CAGATAAGCA CTTTGCTCCC TGGACTGAAA AAGAAAGCAT TTATCTGTTT GCTTCTTGCT
1261 GACAAATCCC TGTGAAAGGT AAAAGTCGGA CACAGCAATC  GATTATTTCT CGCCTGTGTG
1321 AAATTACTGT GAATATTGTA AATATATATA TATATATATA TATATCTGTA TAGAACAGCC
1381 TCGGAGGCGG CATGGACCCA GCGTAGATCA TGCTGGATTT GTACTGCCGG AATTC

Cuando traducimos el código de ADN para ver la cadena de aminoácidos obtenemos una larga proteína:

EFRKRARDKSWHQIQLEIRTDVWQLPQRIHMIMITSEDYAMEFVALGGRIAG

SPTPFPDEAGAFLGLGGGERTEAGGLLATPQWVPPATQMEPPHYLELLQPPRG

SPPHPSSGPLLPLSSGPPPCEARECVMARKNCGATATPLWRRDGTGHYLCNWA

SALLVSKRAGTVCSHERENCQTSTTTLWRRSPMGDPVCNNIHACGLYYKLHQV

NRPLTMRKDGIQTRNRKVSSKGKKRRPPGGGNPSATAGGGAPMGGGGDPSMPP

PPPPPAAAPLKATLCTLSAPWSFRAIFCPLETPEGFLGGGRGVTRPPRG

Si comparamos esta secuencia con la secuencia de la proteína real Eryf1 de gallina, comprobamos que hay 14 aminoácidos de más, agrupados en cuatro bloques, formando la frase MARK WAS HERE NIH (Mark estuvo aquí, NIH).

EFRKRARDKSWHQIQLEIRTDVWQLPQRIHMIMITSEDYAMEFVALGGRIAGS

PTPFPDEAGAFLGLGGGERTEAGGLLATPQWVPPATQMEPPHYLELLQPPRGSP

PHPSSGPLLPLSSGPPPCEARECVMARKNCGATATPLWRRDGTGHYLCNWASA

LLVSKRAGTVCSHERENCQTSTTTLWRRSPMGDPVCNNIHACGLYYKLHQVN

RPLTMRKDGIQTRNRKVSSKGKKRRPPGGGNPSATAGGGAPMGGGGDPSMPPP

PPPPAAAPLKATLCTLSAPWSFRAIFCPLETPEGFLGGGRGVTRPPRG

Probablemente Mark no contó lo de este mensaje a Michael Crichton, y fue únicamente un mensaje de científicos para científicos.

Por cierto, para celebrar el día del ADN (25 de Abril) si te han entrado ganas de hacer lo mismo que Mark, puedes obtener una secuencia de ADN con tu nombre codificado en esta página. Además te puedes enterar que animal contiene tu secuencia personal. ¡Feliz día del ADN!

Para saber más:

Nota:

Esta entrada participa en la XII edición del carnaval de Biología que se hospeda en el blog “Blog de laboratorio“. Recomiendo visitarlo para ver los artículos de los demás compañeros.


Ciencia Fringe: Eterna juventud

En el segundo capítulo de Fringe (1×02 La historia de siempre), y en un capitulo mas posterior (3×07 Abducción), el protagonista del capitulo es un hombre que consigue mantener la juventud capturando a victimas y drenando su glandula pituitaria. (Probablemente con ideas como esta Fringe nunca sea un programa de horario infantil).

No hace falta decir que comerse la pituitaria de la persona que tengas al lado no retrasará tu envejecimiento (unicamente provoca una hipertensión pasajera), pero la idea de obtener la eterna juventud siempre ha sido un sueño perseguido en el mundo de la ciencia. El mayor descubrimiento en este campo y que ha abierto esperanzas es el descubrimiento de los telómeros y el mecanismo de la telomerasa. Esto valió el premio nobel de medicina a los científicos Elizabeth H. Blackburn, Carol W. Greider y Jack W. Szostak en 2009 por sus trabajos sobre la actuación de estos mecanismos en el proceso de envejecimiento.

Antes de meternos de lleno en el mundo de los telómeros y la vejez, vamos a pensar un poco en que definimos como envejecimiento.

Las bacterias y las células de nuestro cuerpo se dividen de manera asexual; esto es, una célula madre duplica su material genético (su ADN), crece y acaba dividiéndose en dos células hijas idénticas a la madre, cada una con una copia del ADN materno. Sin embargo, hay una gran diferencia en este proceso en células humanas y en bacterias: la bacteria es capaz de duplicarse todas las veces que quiera de manera ilimitada y nuestras células tienen un tope de divisiones: se dividen un determinado número de veces y automáticamente mueren. En nosotros la muerte por vejez se produce cuando nuestras células llegan al límite de divisiones y comienzan a fallar.

La causa de esta limitación reside en el mecanismo de duplicación del ADN: este mecanismo (basado en la ADN polimerasa) tiene como defecto que deja los extremos sin duplicar; por lo que en cada división de nuestras células el ADN se acorta un poco hasta empezar a afectar a información importante para la célula, dando su muerte.

¿Y por que las bacterias no tienen este problema? Aunque tengan un mecanismo de duplicación de ADN diferente, este problema de acortamiento de los extremos también debería producirse, pero su ADN es circular ¡por lo que no hay extremos!

Nuestras células no pueden permitirse perder información de ADN importante que se sitúe en los extremos; por esto existen unas repeticiones en los extremos que no almacenan información y que son perdidas en cada división (cada división pierde una repetición). Estas secuencias se llaman telómeros. En caso de los seres humanos, la secuencia que se repite es TTAGGG y se calcula que esta repetida unas 2000 veces al nacer.

Se puede decir que al nacer empezamos a envejecer. Cuando nacemos tenemos unos extremos teloméricos de 2000 repeticiones; pero a medida que crecemos y a lo largo de nuestra vida los extremos teloméricos se van acortando hasta desaparecer. Cada célula se divide a una velocidad diferente; por lo que ahora mismo las células de tu tejido pulmonar son más jóvenes, y por lo tanto, conservan telómeros mas largos; que las células de tu piel, que se dividen más rápido y tienen telómeros mas cortos. Por eso al envejecer lo primero afectado es la piel y vienen las arrugas.

Nos falta un detalle importante: ¿Qué pasa antes de nacer? Un espermatozoide fecunda un óvulo y se forma un cigoto; que tras un alto número de divisiones acaba por formar el feto humano. Durante todo este proceso el número de repeticiones en el telómeros se mantiene constante; si empezáramos a perderlo tras la fecundación nuestra vejez sería mucho más prematura de lo que actualmente es.

Los investigadores descubrieron en la década de los 80 a la telomerasa: esta proteína únicamente se expresa en estado embrionario y permite la duplicación de los extremos, actuando  como protector de los telómeros manteniendo su número de repeticiones en cada división.

Pero aunque esta telomerasa solo se expresa en estado embrionario; durante toda nuestra vida mantenemos este gen silenciado. Si conseguimos modificar nuestras células para que se exprese de nuevo, podríamos aumentar nuestra longevidad. El 28 de noviembre de 2010, Nature publicó una investigación prometedora: se ha probado a expresar este gen en ratones adultos y el resultado ha sido una reversión de  todos los efectos del envejecimiento. Precisamente el efecto rejuvenecedor que aparece en Fringe.

Sin embargo, esta idea tiene puntos débiles: la telomerasa suele expresarse en las células cancerosas promoviendo la formación del tumor. Ten en cuenta que un cáncer es una repetición descontrolada y veloz de una célula, si la telomerasa no llegara a expresarse, el cáncer se encontraría con el tope de repeticiones demasiado pronto. Por eso mismo los ratones (o los humanos) que expresaran telomerasa rejuvenecerían pero aumentarían mucho la probabilidad de tener un tumor.

Actualmente se busca la manera de expresar nuestra propia telomerasa en el ser humano; si se consigue se calcula que nuestra esperanza de vida sea mayor a 100 años. Y es una revolución que se calcula que se conseguirá pronto, probablemente tu consigas vivir más de 100 años, y todo sin la necesidad de comerse ninguna glándula pituitaria.

Una inesperada cura del VIH

Siento la falta de actualización del blog pero es que el periodo de laboratorio se ha vuelto más intenso y queda poco tiempo para esto (que se le va a hacer, escribir los propios artículos requiere tiempo y esfuerzo) pero que sepáis que no he muerto y seguiré actualizando. Además, quería desearos feliz año nuevo y felices fiestas, ya seáis de Reyes Magos, Papa Noel o Festivus.

Este artículo trata de un caso clinico de Berlin (Alemania) que ha salido recientemente y que los medios de comunicación se han hecho notar: un paciente ha sido curado de VIH.

Dicho así, puede parecer sensacionalista, por lo que me puse a investigar el caso para saber más sobre la curación. El paper original esta aquí:

Evidence for the cure of HIV infection by CCR532/32 stem cell transplantation

Me ha sorprendido ver que la causa de esta curación la tiene la mutación CCR5Δ32 de la cual hablamos en un artículo anterior ya que los portadores de dicha mutación son inmunes a la infección por VIH porque impide la unión del virus con los linfocitos T a los que infecta.

El paciente en cuestión tenía dos enfermedades: el SIDA producido por VIH controlado por fármacos de manera que únicamente fuera en fase crónica; y leucemia, la cual estaba siendo tratada por quimioterapia sin muchos resultados.

Para tratar la leucemia se decidió realizar un trasplante de medula ósea, de esta forma el paciente obtendría un sistema inmune nuevo y libre de cáncer. Como os estáis imaginando, el donante de la medula ósea fue un portador de la mutación CCR5Δ32, inmune ante el VIH; de manera que al ser trasplantado el paciente empezó a crear linfocitos T inmunes al VIH, de manera que el VIH no pudiera reproducirse y desapareciera de su organismo. Además, la destrucción absoluta del anterior sistema inmune por la quimioterapia favoreció la formación del nuevo sistema.

El trasplante fue realizado en 2007, tres años después se ha comprobado que ya no existe la presencia del virus en su organismo, sin la toma de antirretrovirales: El paciente se ha curado del SIDA.

Por supuesto, este proceso fue totalmente fortuito, no sabían que el donante tenía dicha mutación, pero abre posibilidades nuevas sobre tratamientos con células madre con la mutación para tratar el SIDA. ¡Nadie había pensado que esta protección de la gente con mutación pudiera ser transferida con un trasplante de medula ósea!

De todas maneras, este proceso no es la panacea, hay que tener en cuenta las siguientes consideraciones:

  • Un trasplante de medula ósea es muy peligroso, un tercio de los trasplantes salen mal, acabando en la muerte, ya sea por complicaciones en el proceso o por alguna infección residente que aprovecha el momento de inmunosupresión absoluta para infectar mortalmente al paciente.
  • El donante de esta historia tenía la mutación, pero es necesario que el donante y el receptor compartan los mayores rasgos genéticos posibles a la hora del trasplante para evitar problemas de rechazo (deben coincidir en la mayor cantidad posibles de marcadores de histocompatibilidad), por ello se buscan hijos o hermanos sanos, reduciendo el número de donantes posibles.
  • Y por último, la mutación CCR5Δ32 afecta a la infección del virus VIH, pero a medida que la infección por VIH se desarrolla hasta dar SIDA, se ha comprobado que el virus cambia, pudiendo infectar a los linfocitos T mutados por receptores diferentes. Este cambio en el virus es gradual, por lo que parece necesario que el paciente haya sido infectado de manera relativamente reciente con el VIH, a medida que pasa el tiempo la mutación se vuelve menos protectora y es menos posible que reviertan los síntomas. (Para mas informacion sobre el cambio de tropismo de VIH pinchar aqui)

Puedo parecer pesimista, pero son problemas que toca sortear para un tratamiento de este tipo. Aun queda mucho por hacer.

Aunque ahora toca comprobar si es reproducible (el pensamiento científico no acepta nada sin esa condición) hay que mirarlo como un nuevo paso al futuro, y nuevas posibilidades de curación mediante terapia génica. Ya sabíamos que la mutación daba protección, ahora hemos descubierto un mecanismo de entrada.

Cuando el DNA salta

Tendemos a ver el DNA como algo rígido, con una información que no puede variar si no es por mutaciones y que es permanente a lo largo de nuestra vida. Sin embargo esto no es así, nuestro DNA cambia a lo largo de nuestra vida mediante dos procesos: los transposones y la epigenética. De la epigenética tratare en otro artículo, hoy hablare de los transposones.

Los transposones son secuencias de DNA normalmente pequeñas que tienen la habilidad de cambiar de sitio en el genoma. Estas secuencias pueden ser de diversos tamaños pero como mínimo tienen una secuencia que se traduce en una proteína llamada transposasa, la cual tiene la capacidad de coger un transposón, “cortarlo” del DNA e insertarlo en otro sitio, normalmente en una zona al azar.

Existen diferentes tipos de transposones según su manera de moverse por el genoma. Los transposones no replicativos son cortados y pegados en otra región de DNA moviéndose, en cambio, los transposones replicativos que se van copiando e insertando en otros nuevos, aumentando el número de copias cada vez.

Algunos de estos transposones entran en la categoría de retrotransposones, ya que la secuencia es parecida a la de un retrovirus, solo que no es posible la infección y solo se dedica a moverse o duplicarse a lo largo del genoma.

Durante mucho tiempo se ha estado discutiendo sobre el porqué de la existencia de estos transposones. Actualmente la explicación mas convincente es que estos transposones tienen una simbiosis con la célula: los transposones son secuencias de DNA “egoísta”, que tiene como objetivo la perpetuación dentro del genoma residente; a cambio el DNA de la célula se beneficia de estos saltos ya que, al ser producidos al azar da pie a la formación de nuevas mutaciones y eso ayuda a una mayor capacidad evolutiva.

Si un transposón se pone en medio de una secuencia que codifica para alguna proteína esencial para la vida, la célula moriría; sin embargo, este caso es menos frecuente de lo que en un principio se piensa, ya que el DNA es muy grande y la mayor parte del mismo no codifica para ninguna proteína, son secuencias intrónicas. Lo más normal es que el transposón salte a secuencias que no llegan a leerse, pudiendo llegar a crear nuevas proteínas en caso de suerte, pero la evolución tiene todo el tiempo del mundo.

El descubrimiento de los transposones también es un tema interesante. Fueron descubiertos por Bárbara McClintock en 1947 usando como modelo de investigación mazorcas de maíz, sin embargo no se la creyó en la comunidad científica y posteriormente se llegó a pensar que los transposones eran únicamente una particularidad del maíz. No fue hasta unas investigaciones en los años 70 que se le dio crédito a su investigación, nombrándola como autentica descubridora de los transposones y recibiendo el Nobel en 1983, cuando tenía 81 años.

Los transposones son especialmente importante en plantas pero en la actualidad se han descubierto transposones en todos los organismos vivos, incluyendo humanos, por supuesto.

En nuestro caso todos los transposones estan apagados y controlados para que no puedan saltar. Sin embargo, recientemente se ha podido comprobar que hay transposones que saltan libremente en el tejido neuronal, esto da que pensar que puede ser la causa de la diferencias entre cada red neuronal. Los transposones saltan al azar, dando una combinacion unica, y precisamente ser unico es lo que necesita un cerebro.

Lo que no te mata te hace fuerte: Peste negra y VIH

Ya hemos hablado varias veces del VIH y del SIDA en este blog, en uno de los casos he tratado sobre el hecho de que el hambre también produce inmunodeficiencia, la cual puede falsear los resultados sobre infectados de VIH en el mundo; y el segundo artículo se basa en la presencia de falsos positivos y falsos negativos en los análisis, usando los análisis de VIH como ejemplo.

Este creo que será mi último artículo sobre este tema, en el hablaremos sobre mutaciones que producen una inmunidad ante la infección de VIH.

Antes vamos a hablar grosso modo sobre el mecanismo de infección del VIH. Este virus usa como sitio de unión el receptor CD 4, el cual está presente en las células T CD4+ del sistema inmune. Estas células T tienen como función proteger nuestro organismo de las infecciones intracelulares, como por ejemplo una bacteria que entra en nuestras células para infectar u otros virus; además estas células actúan mediante la activación de las células B y las células T CD8+ actuando de interruptor del sistema inmune en el proceso de infección.

El virus VIH infecta a estas células T entrando en un equilibrio en el cual los linfocitos T van reduciéndose poco a poco a medida que los niveles de virus crecen, llegando a un nivel de linfocitos T mínimo que impide su actuación en la respuesta inmune. Este estado de inmunodeficiencia es lo que llamamos SIDA.

La parte clave de este proceso es el mecanismo de entrada en las células por el virus. El VIH se ancla a la proteína CD4 para entrar, pero necesita la ayuda de dos proteínas ambas esenciales para la entrada del virus: las proteínas CCR5 y CXCR4.

Estas dos proteínas actúan como apoyo para la entrada del virus, si alguna de estas proteínas no está en la membrana el virus no puede entrar y no se produce la infección. Esto es importante ya que hay una mutación que afecta a la proteína CCR5, la mutación CCR5∆32, esta mutación produce esta proteína que funciona pero no puede unir el virus de manera que las personas con esta mutación son inmunes al SIDA.

Lo curioso de esta mutación es que si comprobamos el porcentaje de población con la mutación vemos que en Europa hay un 1% de personas homocigotas para la mutación (es decir, que tiene las dos copias mutadas, siendo inmune al SIDA), y un 20% heterocigotos (con una copia mutada y la otra sin mutar, esta gente no es inmune al SIDA, pero sí que se produce una infección menos virulenta). En cambio si comprobamos el porcentaje de población con la mutación en el resto del mundo vemos unas cifras mucho más bajas, es decir, que esta mutación esta especialmente presente en la gente europea. ¿Por qué?

Según la teoría de la evolución de Darwin, probablemente la mayor proporción de esta mutación sea debida a que tener la mutación ha sido favorable en algún momento de la historia, manteniéndose en mayor proporción en la población. Se ha estudiado esta mutación y se ha podido comprobar que el origen de esta mutación ha debido de ser aproximadamente hace 600 años. Tirando de libro de historia podemos ver una causa de que la mutación permanezca en Europa: la peste bubónica del siglo XIV.

Esta peste bubónica llego a matar a un tercio de la población europea. Es posible que la gente con la mutación CCR5∆32 tuviera algún tipo de inmunidad parcial a la peste, de manera que la gente sin mutación tuviera mayores posibilidades de infectarse y morir. De esta manera el porcentaje de gente con la mutación aumento respecto a la normal, siendo mantenida hasta la actualidad. El resto de zonas como África y América no sufrieron las consecuencias de la peste bubónica, de manera que no tuvieron esa presión evolutiva y la mutación es mucho menos frecuente.

Es curioso pensar cómo funciona la evolución humana. Se producen mutaciones beneficiosas a veces durante la historia humana; pero no se llega a ver en un número alto hasta que haya una crisis que nos ponga a prueba. Ya lo decía mi abuela: lo que no te mata, te hace fuerte.